PTM Viewer PTM Viewer

AT1G69170.1

Arabidopsis thaliana [ath]

Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein

No PTMs currently found

PLAZA: AT1G69170
Gene Family: HOM05D000159
Other Names: AtSPL6,SPL6,SQUAMOSA PROMOTER BINDING PROTEIN (SBP)-domain transcription factor 6

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 405

MDSWSYGRSVFMSNETLLPCDTFAKNRRFEQRLSNNDDVLISDMAGNSNGFSAVSITKVVPEEEDEENISSSSKFSSQELNRIDFKLRSFLDLGNDDDDTSSRGFALPSKKSRASNLCSQNPLCQVYGCSKDLSSSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCSRFHFLSEFDDGKRSCRRRLAGHNERRRKPAFYFLPGKRHKLLRTSQDVVGNKFLENSSLVLPESFPGSLLYRVIDEDDHRTSRLVSFKDEPTCSMFPTNEQNSSRTYESKPAIYSTEVSSIWDLHETAASRSTRALSLLSAQSQQHLSKFPNTTFSITQPNQNLNHSSSTDYHQMEQPLWIDPGKTNSAGSSSCKGKGTSTVDLLQLSSHLQRIEQQRNYTGDVKQEYNELYFPGS

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR004333 121 198
Sites
Show Type Position
Active Site 124
Active Site 129
Active Site 146
Active Site 149
Active Site 165
Active Site 168
Active Site 172
Active Site 184

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here